PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00005212-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family MYB_related
Protein Properties Length: 335aa    MW: 36187.1 Da    PI: 7.161
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00005212-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.82.1e-1299143347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +WT+eE+  ++ + ++lG+g+W+ I+r     Rt+ q+ s+ qky
  WALNUT_00005212-RA  99 PWTEEEHRMFLLGLQKLGKGDWRGISRNYVVSRTPTQVASHAQKY 143
                         7*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.23792148IPR017930Myb domain
SuperFamilySSF466896.36E-1794149IPR009057Homeodomain-like
TIGRFAMsTIGR015572.5E-1995147IPR006447Myb domain, plants
SMARTSM007171.5E-996146IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.6E-1197142IPR009057Homeodomain-like
CDDcd001673.14E-999144No hitNo description
PfamPF002494.6E-1099143IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MTRKCSHCSH NGHNSRTCPN RGVKLFGVRL TDGSIRKSAS MGNLSHYAGL GSGINHAGSN  60
TPGSPCETPD HDAAADGYAS EDFVPGSSSS CRERKKGIPW TEEEHRMFLL GLQKLGKGDW  120
RGISRNYVVS RTPTQVASHA QKYFIRQTNV SRRKRRSSLF DIIADESVET QMVPHDFLSA  180
NQSQADETQC NPPLPTTPAL DEECESMESI NSTDGDSVPP KPDSSQPSYP VVYPAYFSPI  240
FPFSLPFWSG YTTEETKKET HEVLKPTAVH SKSPINVDEL VGMSKLSLGE SIGPAGSSSL  300
SLKLVEGSSR QSAFHANPGS GSSSINSSSS PIHAV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008448819.10.0PREDICTED: transcription factor MYB1R1
TrEMBLA0A0A0L2630.0A0A0A0L263_CUCSA; Uncharacterized protein
STRINGPOPTR_0001s15510.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF72303145
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.11e-127MYB_related family protein